Protein Info for ABIE51_RS09415 in Lysobacter sp. OAE881

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF21016: RlmN_N" amino acids 1 to 61 (61 residues), 95.4 bits, see alignment E=1.3e-31 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 2 to 358 (357 residues), 443 bits, see alignment E=3.6e-137 PF04055: Radical_SAM" amino acids 105 to 273 (169 residues), 65.2 bits, see alignment E=8.8e-22

Best Hits

Swiss-Prot: 81% identical to RLMN_STRMK: Dual-specificity RNA methyltransferase RlmN (rlmN) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 81% identity to sml:Smlt2055)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>ABIE51_RS09415 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN (Lysobacter sp. OAE881)
MNLFDLDRASLERFFEETLGEKKFRAHQVMKWIHHRYVTDFAEMTDLGKALRAKLEASAE
VRVPQVVFDKASTDGTHKWLLGMDPKNAIETVYIPDKGRGTLCVSSQVGCALNCQFCSTA
TQGFNRNLSTAEIIGQVWVAARHLGNVPHQQRRLTNVVMMGMGEPLANFDNVVRAMSIMR
DDLGYGLANKRVTLSTAGMVPMIDRLALESDVSLAVSLHAPNDELRSELVPLNKKYPIEQ
LMDACVRYALRKRGTSVTFEYTLMKGVNDQPQHARQLLRLMRQFDNAVQMKDAAKVNLIP
FNPFPGTRFERPDDAAIRAFQKLLNEAGMIAPVRRTRGDDIDAACGQLKGQVMDRTRRQA
EFQKQLQARGLGNEAA