Protein Info for ABIE51_RS09365 in Lysobacter sp. OAE881

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 73 to 210 (138 residues), 102.2 bits, see alignment E=1.5e-33

Best Hits

KEGG orthology group: None (inferred from 54% identity to sml:Smlt2047)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>ABIE51_RS09365 glycosyltransferase family 4 protein (Lysobacter sp. OAE881)
MLEWLVVHFCIGIAGTWLARRYALMRSLIDQPGERRSHSVATPRGGGIAIVISLLVAAVA
LGVRQPEQAPLMLAFGVGLLMVAGIGWVDDHRPLSPWIRLGVHVLASALFAMAIGDLYDS
MWLGLAAFVSTLVLTNVWNFMDGINGLAASQALIAAVGLAWIAGGAWTLLALALAAACLG
FLPFNFPKARIFMGDVGSGAIGFALGALCAIAGARSGERFAIVLLPVSVFLVDATLTLLR
RLLRGERWWTPHTQHAYQAWSRAAGHGRVTACYAAVSAVVIIVGWGVLARDAFFIAGTVI
AWYMCCAFFWLVLQKKFPGAAS