Protein Info for ABIE51_RS09325 in Lysobacter sp. OAE881

Annotation: agmatine deiminase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04371: PAD_porph
  • amino acids 13 to 345 (333 residues), 380.2 bits, E=4.3e-118

Best Hits

KEGG orthology group: None (inferred from 81% identity to psu:Psesu_1380)

Predicted SEED Role

"Agmatine deiminase (EC 3.5.3.12)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.12)

MetaCyc Pathways

• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.12

Protein Sequence (350 amino acids)

>ABIE51_RS09325 agmatine deiminase family protein (Lysobacter sp. OAE881)
MNQNTRAQSTHARFPAEWEPQSAVLIAWPNADTDWADRLGEVEETYIALVAAITRFQDAI
VCVADEDVEAYARARLSSARVDMAKVRFIEAPYDDTWLRDSGPITLRDGNGFRLLDFRFT
GWGGKFDASQDDLLVERLTEAGIFSNSARQSIDFALEGGAIDTDGDGTLLTTWQCLHERH
PDASRQELTTRLADWLKQDRVLWLDHGYLEGDDTDAHVDTLARFAPGDAIVFQACDDESD
SHYAELKAMGDEIAALRTKDGKPYRLFPLPWAQPILDDGRRLAASYANFLIVNGAVLMPA
YGDDADAKAQAVLADAFPGREIVPVPCRSLIWQNGSLHCITMQLPQGVVA