Protein Info for ABIE51_RS09170 in Lysobacter sp. OAE881

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00578: AhpC-TSA
  • amino acids 3 to 94 (92 residues), 27 bits, E=5.6e-10
• PF00255: GSHPx
  • amino acids 5 to 111 (107 residues), 149.5 bits, E=3.6e-48
• PF08534: Redoxin
  • amino acids 5 to 153 (149 residues), 26.6 bits, E=7e-10

Best Hits

Swiss-Prot: 57% identical to GPX1_SYNY3: Hydroperoxy fatty acid reductase gpx1 (gpx1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 69% identity to axy:AXYL_02866)

MetaCyc: 57% identical to hydroperoxy fatty acid reductase 1 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Protein Sequence (160 amino acids)

>ABIE51_RS09170 glutathione peroxidase (Lysobacter sp. OAE881)
MTTAYDFTATDIDGQPRSLGEFQGKALLIVNVASKCGFTPQYTGLEKLQRDYAARGFDVL
GFPCDQFGHQEPGDEAEIKNFCSLTYDVTFPMFAKVDVNGDAAHPLWKWLKDEKGGLLGI
DAIKWNFTKFLVGRDGRVLKRYAPTDKPESIAKDIEAALA