Protein Info for ABIE51_RS08875 in Lysobacter sp. OAE881

Annotation: mechanosensitive ion channel domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 182 to 248 (67 residues), 43.5 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: None (inferred from 65% identity to psu:Psesu_2307)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>ABIE51_RS08875 mechanosensitive ion channel domain-containing protein (Lysobacter sp. OAE881)
MDRGFWEQAGAIAWPLTIALVLGLLVHRALLALSRRADAHAATRMRARITQIIALPAAVA
LPLVFLSVAVRAVPLPEDWLDRIQHWLGVGTLLCFTWLVVRAIGAIERRILRQNPVEVAD
NLEARRIQTQTRVLSRIAQGVAILAGVSIALMTFPAIRQIGTTLLASAGIIGLVAGIAAK
PVFGNLIAGLQIAVAQPIRLDDVVIVQGEWGRIEEIDSTYVVVRIWDERRLVVPLQWFIE
NPFENWTRTTSQLLGTAFLWLDYRTPMAEVRKALQHICETDERWDGRVCVAQITDSDQST
LQVRLLVSARNSGDLFDLRCAVRERMIEFLNASHPYALPRVRVARAIRAAGDSESRQAGP
REIGEQTTSPGAEDVNDADVARAAAQPE