Protein Info for ABIE51_RS08870 in Lysobacter sp. OAE881

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 117.9 bits, see alignment E=1.1e-37 PF17912: OB_MalK" amino acids 236 to 293 (58 residues), 52.1 bits, see alignment E=1.9e-17 PF08402: TOBE_2" amino acids 286 to 356 (71 residues), 51.7 bits, see alignment E=1.6e-17 PF03459: TOBE" amino acids 301 to 354 (54 residues), 32.2 bits, see alignment 2e-11

Best Hits

Swiss-Prot: 53% identical to UGPC_SALTY: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>ABIE51_RS08870 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Lysobacter sp. OAE881)
MAKVTLDRLRKVYPNGFVGVDDATFDIGDGELLVLVGPSGCGKSTLLRMIAGLETITAGE
LRIGDRVVNDVAPKDRDIAMVFQSYALYPHMTVAENLGFGLKLRGASKDDIARRVTESAQ
MLELESLLDRKPAALSGGQRQRVALGRALVRQPQVFLLDEPLSNLDAKLRASTRVEIARL
HRKLGTTMIYVTHDQVEAMTLGQRIVVLDKGRIQQIDTPMALYNRPANLFVATFLGSPKM
NLLEGEVVQRGDDLALRLADGVELPLQPEAELRAVLRGFAGKRLTVGLRPEDLSLAAPGA
GQLQARVETVEPIGNEAFLNLACGGGELVVRLPPRNLPGPGDTVYLGHNPEHMHYFDPES
GRSLRA