Protein Info for ABIE51_RS08825 in Lysobacter sp. OAE881

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 262 (174 residues), 83 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 43% identical to ARAQ_BACHD: L-arabinose transport system permease protein AraQ (araQ) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K10190, lactose/L-arabinose transport system permease protein (inferred from 74% identity to sml:Smlt3250)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABIE51_RS08825 carbohydrate ABC transporter permease (Lysobacter sp. OAE881)
MSPRLAKAIVNGLMIALAVISLAPLLWMLSVSFMQPGEAAHFPPPLLPAAPTLHNYHELF
ARAGMGRYLLNSAMIATAATLIALLLNTMAGYAFAKLKFAGRERVFRLLLAALIIPAQVT
MMPLFLMLKQMGLVNTYAGAIVPLMASVFGIFLVRQYARSIPDELLEAARIDGASETRIF
FQIVLPVLKPILVTLAIFVFLGAWNDFMWPLIVLSDAGHFTLPVALASLSREHVQDNEMM
MAGSVVTVLPVLILFLALQRYYLQGLLVGSVKG