Protein Info for ABIE51_RS08820 in Lysobacter sp. OAE881

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 289 (191 residues), 72.3 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 39% identical to LACF_RHIRD: Lactose transport system permease protein LacF (lacF) from Rhizobium radiobacter

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 74% identity to psu:Psesu_1285)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 1" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABIE51_RS08820 sugar ABC transporter permease (Lysobacter sp. OAE881)
MPRVSASTAGWVFAAPALTVIGVFFGLPVLAAFALSLTDFDIYSLADLSNLRFVGLHNYA
TLLQDPLFWKALGNTMYFVVVGVPLSIAVSLGAALLLHAKSARFKPFFRTAYFAPVVTTV
VAVAVIWRYLFHTRYGLVNWGLTSIGLDPIDWLGDPTWAMPTIILFAVWKNFGYNMIIFL
AGLQSIPEDLYEAARIDGATPAQQFWNVTLPQLGPVLLMVSILTLSGYFQLFAEPYVITQ
GGPLESTVSVLYLMYEQGFKWWNLGNASAVAFLLFALMSVATSGLLWFARRKGAEA