Protein Info for ABIE51_RS08795 in Lysobacter sp. OAE881

Annotation: BolA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 PF01722: BolA" amino acids 14 to 90 (77 residues), 104.8 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 35% identical to UVI31_SCHPO: UV-induced protein uvi31 (uvi31) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K05527, BolA protein (inferred from 78% identity to xal:XALc_1313)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>ABIE51_RS08795 BolA family protein (Lysobacter sp. OAE881)
MPREQRVGAIRAALEAALAPLSLEIEDESHRHAGHAGAADGRGHFRVDVVSEAFAGLGPI
ARHRAVYAALGDLMTTDIHALSIRARTPAEAN