Protein Info for ABIE51_RS08725 in Lysobacter sp. OAE881

Annotation: heme ABC exporter ATP-binding protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01189: heme ABC exporter, ATP-binding protein CcmA
  • amino acids 12 to 204 (193 residues), 228 bits, E=4.2e-72
• PF00005: ABC_tran
  • amino acids 29 to 165 (137 residues), 91.4 bits, E=8.4e-30

Best Hits

Swiss-Prot: 79% identical to CCMA_XANC8: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 79% identity to xca:xccb100_1961)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Protein Sequence (216 amino acids)

>ABIE51_RS08725 heme ABC exporter ATP-binding protein CcmA (Lysobacter sp. OAE881)
MTPHDRPAPPLLAARGLRFARNDEPVFGPLDFSVDAGEALLVQGDNGAGKTTLLRVLAGL
LRSDGGEIDLDGEPAGHARRARAIAYLSHLPGLKADLTAMENLDFLCGLQGRRRAQLPEN
ALGIVGLAGYEDALARQLSAGQKKRLSLARLWMSPAPLWLLDEPYANLDLEGIELVNRMV
QAHLRDGGAALVTTHGAYAAPPVRTRMLVLNKAAAA