Protein Info for ABIE51_RS08720 in Lysobacter sp. OAE881

Annotation: heme exporter protein CcmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 125 (34 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 202 to 228 (27 residues), see Phobius details PF03379: CcmB" amino acids 14 to 227 (214 residues), 210 bits, see alignment E=1.5e-66 TIGR01190: heme exporter protein CcmB" amino acids 16 to 226 (211 residues), 205.3 bits, see alignment E=4.3e-65

Best Hits

Swiss-Prot: 50% identical to CCMB_PSEAE: Heme exporter protein B (ccmB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02194, heme exporter protein B (inferred from 76% identity to xcv:XCV2523)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>ABIE51_RS08720 heme exporter protein CcmB (Lysobacter sp. OAE881)
MTPSTSPSLVGAARALLARDARLLWRRRGDALQPALFALLVVTLFALALGAEKAALSKVA
SAVLWVSMLLAGLLSLDTLFRGDAEDGSLEQWMLAPVPLAWLVGVRTFIHWATTALPLLV
AAPFLGELLYLPREQLPVLMISLALGTPLLSLIGAVVAALTVGMRRSGILVALLALPLYV
PVLVFGAGSVAASAQGLDPTGALLLLGAGLAVALVVAPLAAAAAIRIALS