Protein Info for ABIE51_RS08700 in Lysobacter sp. OAE881

Annotation: heme lyase CcmF/NrfE family subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 82 to 91 (10 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details amino acids 450 to 470 (21 residues), see Phobius details amino acids 482 to 505 (24 residues), see Phobius details amino acids 611 to 630 (20 residues), see Phobius details signal peptide" amino acids 26 to 27 (2 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 635 (583 residues), 740.8 bits, see alignment E=6.8e-227 PF01578: Cytochrom_C_asm" amino acids 89 to 295 (207 residues), 180.5 bits, see alignment E=3.5e-57 PF16327: CcmF_C" amino acids 315 to 633 (319 residues), 399.1 bits, see alignment E=1.6e-123

Best Hits

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 74% identity to smt:Smal_2704)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>ABIE51_RS08700 heme lyase CcmF/NrfE family subunit (Lysobacter sp. OAE881)
MLGEIGQVALILALLVSVLQAALPLAGAQRGVAPWMAVARPAAYAQLALVAFAFVILTHG
FVTQDFSLQYVAENSNSLLPLMYRYTAVWGAHEGSLLLWALILAAWTGAVARFSRNLPET
VIARVLGVMGLVSAGFLAFLIFTSNPFLRLLPAAAEGRDLNPLLQDPGMIIHPPMLYLGY
VGFAVPFAFAIAALLDGKVDARWLRWTRPWTNVAWAFLTLGIALGSWWAYYELGWGGWWF
WDPVENASFMPWLAGAALLHSQAVTEKRGSFRGWTLLLAIATFSLSLLGTFLVRSGVLTS
VHAFAADPARGLFILIFLGIVVGGSLLLYALKAPSSDDAGKPFELFSRETLLLANNLLLS
TACAMVLLGTLYPLLADALELGKISVGPPYFALMFVLLMAPLVLLLPFGPITRWQREQPS
KPLAILMPWAALAVVLAAIAYFMASQGPLKVAAGVLGAAWVLFGTARFVWTRVRSQTTGQ
RFTAEMLGMTLAHFGVAVFLVGALLTEGLTTQRELAVAPGQTVELGRYSFRFDGATHSQG
PNYEADRGTVTVFENGRPLTVMHPEKRAYASGGQVMTEAAIARGVTRDLYVALGEPLGND
AWALRVHIKPFVRWIWAGALLMMLGGFVTATDRRFRRVAEARTPTITATEPTPEPAR