Protein Info for ABIE51_RS08695 in Lysobacter sp. OAE881

Annotation: DsbE family thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 4 to 171 (168 residues), 182.9 bits, see alignment E=2e-58 PF00578: AhpC-TSA" amino acids 36 to 152 (117 residues), 54.7 bits, see alignment E=9.8e-19 PF08534: Redoxin" amino acids 37 to 161 (125 residues), 64.3 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 47% identical to DSBE_PSEAE: Thiol:disulfide interchange protein DsbE (dsbE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 64% identity to psu:Psesu_1266)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>ABIE51_RS08695 DsbE family thiol:disulfide interchange protein (Lysobacter sp. OAE881)
MRWIPLAIVAALGVLLFAGVLLSRNPNRDALPSPLIGKPAPAFRLPVLHEAGRLVTDKDL
RGAPYLLNVWGSWCPACRDEHPVLTRFAETKRLRVIGFNWKDEHADALRWLEQFGNPYLM
VLTDYDGKAAIDWGIYGAPETFLVDGGGIIRWKYVGPLTDEVIANELLPKLAQIDAQVGQ
GKPL