Protein Info for ABIE51_RS08385 in Lysobacter sp. OAE881

Annotation: ribosome maturation factor RimP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF02576: RimP_N" amino acids 11 to 94 (84 residues), 85.2 bits, see alignment E=3.3e-28 PF17384: DUF150_C" amino acids 97 to 162 (66 residues), 76.3 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 66% identical to RIMP_XANC8: Ribosome maturation factor RimP (rimP) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 68% identity to psu:Psesu_1831)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>ABIE51_RS08385 ribosome maturation factor RimP (Lysobacter sp. OAE881)
MADKAVEIANLLAPTVASLGVELLGAEYLPSPGSAVLRLYIDVPADEAVGEDGQPRSVTI
EDCEAVSREVSAQLDVEDPISGMYTLEVSSPGIDRPLFTLAHYARFAGETAKVGLKLPQD
GRRRLQGRIVRVQGNDVVFDVDGNEFVTAFGNIDKARLVPDWAALGMAPVKPGKDKPAKG
APKGGASKAKK