Protein Info for ABIE51_RS08360 in Lysobacter sp. OAE881

Annotation: NADH-quinone oxidoreductase subunit NuoK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 13 to 108 (96 residues), 107.6 bits, E=1.1e-35

Best Hits

Swiss-Prot: 85% identical to NUOK_STRM5: NADH-quinone oxidoreductase subunit K (nuoK) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 86% identity to xal:XALc_1009)

MetaCyc: 48% identical to ferredoxin-quinone oxidoreductase subunit E (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (108 amino acids)

>ABIE51_RS08360 NADH-quinone oxidoreductase subunit NuoK (Lysobacter sp. OAE881)
MSEFFGAGLALGHYLALGAVLFCISVAGIFLNRKNVIMLLMSLELMLLSVNINFVAFSRQ
LSDPAGQVFVFFILTVAAAEAAIGLAILVTLFRNRRTINVAEIDSMKG