Protein Info for ABIE51_RS08350 in Lysobacter sp. OAE881

Annotation: NADH-quinone oxidoreductase subunit NuoI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 19 to 137 (119 residues), 148.8 bits, E=2.6e-48
• PF13237: Fer4_10
  • amino acids 60 to 113 (54 residues), 30.1 bits, E=1.9e-10
• PF00037: Fer4
  • amino acids 60 to 79 (20 residues), 24.2 bits, see alignment (E = 1.1e-08)
  • amino acids 96 to 117 (22 residues), 28.4 bits, see alignment (E = 5.3e-10)
• PF12800: Fer4_4
  • amino acids 61 to 75 (15 residues), 18.1 bits, see alignment (E = 1.3e-06)
  • amino acids 101 to 114 (14 residues), 13.4 bits, see alignment (E = 4.3e-05)
• PF12838: Fer4_7
  • amino acids 62 to 115 (54 residues), 46.5 bits, E=2.1e-15
• PF13187: Fer4_9
  • amino acids 62 to 115 (54 residues), 35.8 bits, E=3.3e-12

Best Hits

Swiss-Prot: 86% identical to NUOI_XYLFA: NADH-quinone oxidoreductase subunit I (nuoI) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 87% identity to psu:Psesu_1837)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (162 amino acids)

>ABIE51_RS08350 NADH-quinone oxidoreductase subunit NuoI (Lysobacter sp. OAE881)
MNRIVSYFKSLLLIELSQGLALTAKYLFKPKYTLMYPMEKTPQSPRFRGVHALRRYPNGE
ERCIACKLCEAVCPALAITIDSTKREDGTRRTTRYDIDLFKCIFCGFCEESCPVDSIVET
HVHEYHFDRRGQNIVTKPQLLAIGDRLEAEIAERRAADAPFR