Protein Info for ABIE51_RS08315 in Lysobacter sp. OAE881

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 37 to 178 (142 residues), 251.9 bits, E=8.5e-80
• PF01058: Oxidored_q6
  • amino acids 63 to 172 (110 residues), 99.4 bits, E=6.7e-33

Best Hits

Swiss-Prot: 93% identical to NUOB_STRM5: NADH-quinone oxidoreductase subunit B (nuoB) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 90% identity to xcb:XC_1590)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (190 amino acids)

>ABIE51_RS08315 NADH-quinone oxidoreductase subunit B (Lysobacter sp. OAE881)
MGVIQSVSDLMHNPLPEGRLDDILRPEGDNPLLQNGFVTTSMDALWNWARTGSMWPMTFG
LACCAVEMMHAGAARLDLDRYGVVFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMPDPK
WVISMGSCANGGGYYHYSYSVVRGCDRVVPVDVYVPGCPPTAEALVYGILQLQKKIRRGT
NFGENMQGVR