Protein Info for ABIE51_RS08250 in Lysobacter sp. OAE881

Annotation: phosphoribosylanthranilate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00697: PRAI
  • amino acids 10 to 203 (194 residues), 156 bits, E=5.2e-50

Best Hits

Swiss-Prot: 61% identical to TRPF_STRM5: N-(5'-phosphoribosyl)anthranilate isomerase (trpF) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 61% identity to smt:Smal_2850)

Predicted SEED Role

"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (16/18 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.24

Protein Sequence (213 amino acids)

>ABIE51_RS08250 phosphoribosylanthranilate isomerase (Lysobacter sp. OAE881)
MNASAHTRIKFCGMTRADDIALACELGVDAIGLVFAQRSSRRLDIEHARALRDVVADGID
VVALFMDNEAAYVQRVIDEVRPTLLQFHGSEDEAFSEAFGVPYLKAVAMGGDVASDALSR
HARAVALLLDSHAAGGAGGTGHRFDWSRIPHDSGRAFLLAGGLHPDNVFEAVNTVHPWGV
DVSSGIESAPGEKDAARMRRFVEEVRRADSLPR