Protein Info for ABIE51_RS08165 in Lysobacter sp. OAE881

Annotation: DUF4010 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 48 to 79 (32 residues), see Phobius details amino acids 95 to 123 (29 residues), see Phobius details amino acids 144 to 159 (16 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details PF02308: MgtC" amino acids 9 to 130 (122 residues), 48.3 bits, see alignment E=1.3e-16 PF13194: DUF4010" amino acids 179 to 388 (210 residues), 123.6 bits, see alignment E=9.6e-40

Best Hits

KEGG orthology group: None (inferred from 38% identity to rcp:RCAP_rcc01319)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>ABIE51_RS08165 DUF4010 domain-containing protein (Lysobacter sp. OAE881)
MDPDELRGLLTAIAIGLLIGVVRERHPLQSDAPHPGAPAAGLRTHAMVAIAAGVAAQIGL
PALVATVLAVGALAVVSYLRTREHDPGLTGEVALLVTTLLAALAQTQTTVAAALAVVAAT
LLFAKQPLHRFARDIVSEREVQDALLLAASALVVLPLLPDEPVDPWGVLVPSQLWKLVVL
VMTVGMLGHIALRAVGARWGLPVAGFFAGFASSTAAVAGFGQRTRADASLTAGAASAALL
ANLASLLLVMGILATAAPSLLRASAWPLAAAAGVLAIAAGFGLQRQADAPSLPNEPQARA
FKLSHGLLLALVIAVVLVLSAWLRSVFGDMGALATAVLVAVAELHAAAASIAQLSSAGNL
TMTHAQWGVAGLLASSAIAKTALAFASGNRRYGFIVGGGLIGMAVACAAVTGVVIASA