Protein Info for ABIE51_RS08045 in Lysobacter sp. OAE881

Annotation: tRNA epoxyqueuosine(34) reductase QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR00276: epoxyqueuosine reductase" amino acids 16 to 350 (335 residues), 491.4 bits, see alignment E=6.2e-152 PF08331: QueG_DUF1730" amino acids 63 to 141 (79 residues), 79.3 bits, see alignment E=2.5e-26 PF13484: Fer4_16" amino acids 193 to 257 (65 residues), 82.3 bits, see alignment E=5.5e-27

Best Hits

Swiss-Prot: 78% identical to QUEG_XANCP: Epoxyqueuosine reductase (queG) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: None (inferred from 78% identity to xcb:XC_1813)

MetaCyc: 57% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>ABIE51_RS08045 tRNA epoxyqueuosine(34) reductase QueG (Lysobacter sp. OAE881)
MPASAPDYGALAARVRELAREFGFQRCGITGVELGEDEAYLRDWLAQGLYGSMDWMARHG
ELRARPDELHPGTVRVISVGLDYGRDRDEAWATLDDSERAYVARYALGRDYHKLMRQRLQ
RLADRIAEVVGPFGHRVFVDSAPVLERALARNAGLGWIGKHTCLIDKDGGSLFFLGEIYV
DLPLPVDVPASAHCGTCRRCIDVCPTQAIVAPYRLDARRCIAYLTIEHEGAIPEDLRAPI
GNRIFGCDDCQLICPWNKFAQRTDEPDFRVRNDLDKATLVDLFAWSEEEFLQRTEGSAIR
RSGHERWLRNIAVALGNARSTPDVIGALRARRESESPMVREHIEWALRRHGADDAA