Protein Info for ABIE51_RS08025 in Lysobacter sp. OAE881

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF02548: Pantoate_transf" amino acids 18 to 272 (255 residues), 345.9 bits, see alignment E=7.7e-108 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 22 to 277 (256 residues), 320.5 bits, see alignment E=4.5e-100

Best Hits

Swiss-Prot: 78% identical to PANB_XANC5: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 78% identity to xcv:XCV1816)

MetaCyc: 52% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>ABIE51_RS08025 3-methyl-2-oxobutanoate hydroxymethyltransferase (Lysobacter sp. OAE881)
MYSGTPNESSRAAEKAWTVPALAQAKRDGRKLVMLTCYDAGFARTMEDVGIDLVLVGDSL
GMVMQGHDSTIPVTTADVAYHTACVARGLDKTLLIADLPFGADATPERALDASIRLLQAG
AAMVKLEGAAHKLEVIRFLVDREIPVCAHLGLTPQSVLRLGGYKVQGRDEVAARRLREDA
RAVQDAGATLLVLECVPTPVAASITADLDIPTIGIGAGPQCDGQVLVLHDLLGVNSGHRR
PRFVKDFLAEGGSVAGAFAAYAKAVRDGSFPDAEHSYA