Protein Info for ABIE51_RS08020 in Lysobacter sp. OAE881

Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
  • amino acids 9 to 142 (134 residues), 147.7 bits, E=9.9e-48
• PF01288: HPPK
  • amino acids 10 to 142 (133 residues), 135.8 bits, E=4.7e-44

Best Hits

Swiss-Prot: 47% identical to HPPK_METEA: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 60% identity to psu:Psesu_1050)

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.3

Use Curated BLAST to search for 2.7.6.3

Protein Sequence (176 amino acids)

>ABIE51_RS08020 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase (Lysobacter sp. OAE881)
MSETPENRAFIGLGSNLGDSIATLKAALRSLDALPDTRVAIASKLYRTAAWGVTDQPDFI
NAVALLHTRRAPRQLLDDLLEIERHAGRHRLEDGSDRWGPRTLDLDLLLYGHERIDEPGL
HVPHPRLHERAFVLVPLAEIAPDVDIPGVGTAAQALARMAPAQVEGVTYADPLDPA