Protein Info for ABIE51_RS07950 in Lysobacter sp. OAE881

Annotation: XrtA/PEP-CTERM system exopolysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF02563: Poly_export" amino acids 45 to 116 (72 residues), 85.2 bits, see alignment E=2.9e-28 PF10531: SLBB" amino acids 127 to 176 (50 residues), 49.9 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 53% identity to sde:Sde_0132)

Predicted SEED Role

"FIG123464: Polysaccharide export protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>ABIE51_RS07950 XrtA/PEP-CTERM system exopolysaccharide export protein (Lysobacter sp. OAE881)
MRTFRFTAVAAVAAVFGAMLFLSACASSGRGAIAPPPAESENLVDAYQIGIDDIVQVSVW
RNPELGITVPVRPDGKISVPLVGDVSAGGRTPNEVAKEIQERLGAFVRDPQVAVILTDLR
SHEYLSRVRVTGAVRQPISIPFRQGMTVLDAVLAAGGVTEFAAPAKSDLYRKSGDSTRSY
AVRLDHILEDGDLTTNFKVAPGDVITVPERTL