Protein Info for ABIE51_RS07915 in Lysobacter sp. OAE881

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 236 to 253 (18 residues), see Phobius details amino acids 259 to 275 (17 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 244 to 375 (132 residues), 81.4 bits, see alignment E=3.1e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>ABIE51_RS07915 O-antigen ligase family protein (Lysobacter sp. OAE881)
MRGAHPDAGGSRFPLAAKALRGAMPAATRTRLPVVPGSAAAAQPTARATTRAPRNWALYL
FLILLPLQNITAGYLPNIGGGFNFLNVMFLISLFTAMAQGGKLAPNEPVNTWTTVYAVYM
TLSLLVGFHFVDDPTNHFNQLKDHMVGLFVVYVVQMSVRDWNGVRMVVFATLLPLPYIAK
VVWNQHRSVASTHYTDDLRISGTFALLGANEFAAFCVTVAVVLFALLLACRLSRKWKIVL
MGGIACMILGVLYAYSRTAYISLIMGMVVVIMVWRGRLKLILPLCLAVVIAPAVLPKSVV
ERFDSTTVEEGKRDESTELRIEYWKIAWANFLRNPVVGTGYHTFHHREINPYGRDTHNLY
IRTLSEGGVFGAITLLGILLAVLRTAMREVREARTGTWRYALALGMMGAWVSMVIANLFG
DRFTYYPVIAYFWAYMGLVMKARHLPPEDSAR