Protein Info for ABIE51_RS07730 in Lysobacter sp. OAE881

Annotation: cytochrome c biogenesis protein CcsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details amino acids 22 to 24 (3 residues), see Phobius details transmembrane" amino acids 20 to 21 (2 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 46 to 257 (212 residues), 109 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 69% identity to xca:xccb100_3146)

Predicted SEED Role

"CcsA-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>ABIE51_RS07730 cytochrome c biogenesis protein CcsA (Lysobacter sp. OAE881)
MTIVLIAIAMYLVATALLIGGVRQEPTRPSRLWLLPAVGGVALHALAHLLAWHASGGADM
HFYAALSLVALGMAALTALVGAGGRMAALGVIVFPIAALALFGYHHHGHVLGEHLDWRLQ
LHAWMALLAYATLAIAALLAVMLWAQERALRRREFHRWLRALPPLVELETLLFRTIAVGF
ALLTATLLTGLLFVENLFAQHLVHKTVLSVLSWLLFGGLLAGRWRYGWRGAVAVRWTLTA
MALLILAFFGSKFVLELVLRRPA