Protein Info for ABIE51_RS07540 in Lysobacter sp. OAE881

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 81 to 107 (27 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 24 to 316 (293 residues), 301.1 bits, see alignment E=3.6e-94 PF00528: BPD_transp_1" amino acids 103 to 312 (210 residues), 48.1 bits, see alignment E=5.8e-17

Best Hits

Swiss-Prot: 81% identical to PSTC_XYLFA: Phosphate transport system permease protein PstC (pstC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 86% identity to xal:XALc_1991)

MetaCyc: 56% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>ABIE51_RS07540 phosphate ABC transporter permease subunit PstC (Lysobacter sp. OAE881)
MNATSLPAVEVPKSRDHKDARNDRLFRYVLTGTVIFVLVALASAALSMLWGGRHVLEAEG
LRFFFSTEWNPVENRYGALVPIYGTVVTALIAMLIAVPVSFGIAFFLTEVAPRWARGPIG
TAIELLAGIPSIIYGMWGLFVLVPVMTEYVTPWLNDHVGTLPVIGALFQGPPLGIGMLTA
GIVLAIMVIPFISSVMREVFLTVPTRLKESAYALGSTKWEVSWDIVLPYTRSAVIGGIFL
GLGRALGETMAVAFVIGNSVNFSASLLEPGTTIAALIANDFGEATETYRSALLLLGFVLF
IVTFVVLAIARFMLLKLARKEGN