Protein Info for ABIE51_RS07425 in Lysobacter sp. OAE881

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 15 to 138 (124 residues), 33.5 bits, E=1.9e-11
• PF01370: Epimerase
  • amino acids 17 to 291 (275 residues), 182.3 bits, E=5.2e-57
• PF02719: Polysacc_synt_2
  • amino acids 17 to 136 (120 residues), 36.1 bits, E=2.2e-12
• PF05368: NmrA
  • amino acids 17 to 94 (78 residues), 24.6 bits, E=8.2e-09
• PF00106: adh_short
  • amino acids 17 to 98 (82 residues), 27.3 bits, E=1.2e-09
• PF01073: 3Beta_HSD
  • amino acids 18 to 147 (130 residues), 79.8 bits, E=9.5e-26
• PF16363: GDP_Man_Dehyd
  • amino acids 18 to 142 (125 residues), 84.4 bits, E=5.5e-27
  • amino acids 179 to 355 (177 residues), 80.4 bits, E=9e-26
• PF07993: NAD_binding_4
  • amino acids 19 to 272 (254 residues), 37.8 bits, E=6.2e-13
• PF13460: NAD_binding_10
  • amino acids 21 to 142 (122 residues), 46.1 bits, E=2.8e-15

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 66% identity to vpe:Varpa_3054)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (383 amino acids)

>ABIE51_RS07425 SDR family NAD(P)-dependent oxidoreductase (Lysobacter sp. OAE881)
MTAHEGGNGGTGSRGRVLITGGAGFVGSHVADELLAHGYQVRVLDALAAQVHGDDAQWPA
YLSDEVECMQGDVRDADAVRAALEGVDRVFHLAAAVGVGQSMYEIEHYTDVNNRGTAVLL
EALSRSPVKKLVVASSMSVYGEGLYADASGRAVAPPERDPESLRRGDWELRAHGEPLTPV
PTHEEKPPMPTSVYALSKLDQERLCLIVGQAYGIPATALRFFNIYGTRQALSNPYTGVLA
IFASRYMNGKPPRIFEDGNQRRDFVHVSDIARACRLALESDAATGRAINVGSGVSVSIAE
VAHAMANALEVDGLPPEITGQFRVGDIRHCFADITLARELLGYAPRVTLEQGLAELVEWM
QDQQAVDRVDVAAAELASRGLQR