Protein Info for ABIE51_RS06820 in Lysobacter sp. OAE881

Annotation: exodeoxyribonuclease VII small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01280: exodeoxyribonuclease VII, small subunit
  • amino acids 18 to 71 (54 residues), 75.7 bits, E=1.2e-25
• PF02609: Exonuc_VII_S
  • amino acids 19 to 69 (51 residues), 69.4 bits, E=1.1e-23

Best Hits

Swiss-Prot: 69% identical to EX7S_STRM5: Exodeoxyribonuclease 7 small subunit (xseB) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 76% identity to psu:Psesu_2219)

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Protein Sequence (96 amino acids)

>ABIE51_RS06820 exodeoxyribonuclease VII small subunit (Lysobacter sp. OAE881)
MPRTPAQDDAPSTSPVSDFEQSLDALEQLVEKMEHGEMSLEDSLAAYERGVGLYRRCQSA
LEEAELRVRLLSDPQNPASGEPFSAQDAGSSNRGDV