Protein Info for ABIE51_RS06800 in Lysobacter sp. OAE881

Annotation: ribosome biogenesis factor YjgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF04751: DUF615" amino acids 14 to 167 (154 residues), 167.7 bits, see alignment E=8.8e-54

Best Hits

Swiss-Prot: 72% identical to Y1892_XANOP: UPF0307 protein PXO_01892 (PXO_01892) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K09889, ribosome-associated protein (inferred from 72% identity to xop:PXO_01892)

Predicted SEED Role

"FIG138315: Putative alpha helix protein" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>ABIE51_RS06800 ribosome biogenesis factor YjgA (Lysobacter sp. OAE881)
MRGRDEETGEFFSPSRSQNRREALEVLALGEKLVALTEAQLAKLPVPDSLLPHIREAKRI
TAHIAHKRQLAFLAKQMRREDDEVLEAIRDALDEDGEAARREVAAMHRVEAWRERLLADG
DAALAQLLDEYPTADRQHLRALVRSALDERRKNKPPRAFRELYRALRELIVGGTTGDDDV
EDADESFEDEER