Protein Info for ABIE51_RS06715 in Lysobacter sp. OAE881

Annotation: DUF998 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details PF06197: DUF998" amino acids 19 to 197 (179 residues), 32.4 bits, see alignment E=3.8e-12

Best Hits

KEGG orthology group: None (inferred from 45% identity to sml:Smlt3486)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>ABIE51_RS06715 DUF998 domain-containing protein (Lysobacter sp. OAE881)
MNRPTVPSPASFDRHAGWLAAACCAIAVAGFAATHAAFSHAQHPLGLLGAADVPGASAFN
LLGFIAPGLLAAWVFVRLRARLPVGAGRWAGIGCWMLALSALAFAAQGVWRLDPADLDGP
ISQRHATMWLLWWLAFAAGALVLGAGLLRDRIWRGVSIAFVIAGTVVVLLNAFPVFAGPI
AQRVVLLAWLVCVVVASRSGGVIRIA