Protein Info for ABIE51_RS06585 in Lysobacter sp. OAE881

Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 155 to 182 (28 residues), see Phobius details amino acids 194 to 208 (15 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details PF01384: PHO4" amino acids 19 to 362 (344 residues), 303.7 bits, see alignment E=8.1e-95

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 70% identity to xcv:XCV1745)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>ABIE51_RS06585 inorganic phosphate transporter (Lysobacter sp. OAE881)
MLTLVLVVVFAALAFEYINGFHDTANSIATVVATKVLSPIQAVMLAASTNLLGALWGTAV
AKTIASGLLDTGVVEVTSQLILCALLGAIVWNLITWWKGLPSSSSHALIGGLCGAAVAAA
SNNFHSVIWSHPADPWYKSAGVLWKVVVPMFSSPLLGFAAGFVVMGVLFAIISFMASSGG
VLARMARPRWVNAFFGKAQLVSAAGMGFAHGMNDAQKTMGIIALALVGAQAAGTLDNLPS
WLAFLHPSQAALENNDIDLWIKLTCAVVMAAGTAAGGWRIIKTLGHKLVKLHPINGFAAE
TSAAAVIMAASSLGIPVSTTHNISSAIMGVGTAKRFNAIKWTVVEKMIWAWILTIPAAGG
IAYAFFELFRFFGWA