Protein Info for ABIE51_RS06550 in Lysobacter sp. OAE881

Annotation: FtsH protease activity modulator HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01933: HflK protein
  • amino acids 67 to 321 (255 residues), 304.6 bits, E=2.8e-95
• PF01145: Band_7
  • amino acids 69 to 240 (172 residues), 121.7 bits, E=1.9e-39

Best Hits

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 60% identity to psu:Psesu_0806)

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (371 amino acids)

>ABIE51_RS06550 FtsH protease activity modulator HflK (Lysobacter sp. OAE881)
MAWNTPGSDNSGGPNGRNPRRRPGGRGLDALIDPLRGLFGGGAGGGGSILRWVGIVFALW
LVFNCFVLVTEQERGVVLRFGQFARVLDPGPHFKAPWPIERVTKVNATQSNAYSDTVPVF
TRDANMVNVEINVQYRIGDPQMYLFGSRDADRVLKEAAQSAVREQVGRSDLDTVLNARSE
LTTTVRQQLQASLQTYRTGLFVTELNLPNARPPDEVKDAFDEVQRAASDKTTQINQAQAY
AKQVVPEARGQAAQVRAAAEGYKTASIARAEGDASRFSQMVEEYKNAPEVTRKRLWLDTV
QDVLSDNRTIVGGDGRNVIYVPMGERRAPTPTPNSPLLTPDLLAPPTTTESSDSARPTRS
PRPSGREEVTR