Protein Info for ABIE51_RS06495 in Lysobacter sp. OAE881

Annotation: YqaA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 80% identity to sml:Smlt1723)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>ABIE51_RS06495 YqaA family protein (Lysobacter sp. OAE881)
MKIFGPLYERALVWARHRHAPAYLVGLSFIEAIIFPIMPEVMLAPMCVAQPRRGFWFATI
SLAGSMVGALVGYALGHYAFEAVKPLFAALGMLGGIESGIATVQAKMAESPWAVFWLLVL
GGFAPIPMKVFTWASGIVGVPMPQYVLSMLIGRGKRVYLIALVIRIGGVRAEAALRRYIE
PIGWIALALLIAAICFLVWKTQLG