Protein Info for ABIE51_RS06250 in Lysobacter sp. OAE881

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01224: imidazolonepropionase" amino acids 32 to 404 (373 residues), 448.9 bits, see alignment E=6.3e-139 PF01979: Amidohydro_1" amino acids 68 to 382 (315 residues), 85.7 bits, see alignment E=3.9e-28 PF07969: Amidohydro_3" amino acids 193 to 382 (190 residues), 58.1 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 64% identical to HUTI_RALSO: Imidazolonepropionase (hutI) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 74% identity to psu:Psesu_2247)

MetaCyc: 60% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>ABIE51_RS06250 imidazolonepropionase (Lysobacter sp. OAE881)
MTSNAHTAWDGLILGASLATLDAPAGYADILDGALAWKDGTLAYVGPRSGLPDAPQRLAR
EVIEAKGWITPGLVDCHTHLVFAGDRAREFELRLLGASYEDIARSGGGILSTVRATRAAD
EGELLRQSLPRAHALISDGATTVEIKSGYGLDFDNERKMLRVARRLEQLGVGVRTTYLAA
HALPPEYAGRADDYIDAAIEWLPKLHAEGLVDAVDAFCEGIGFTPDQTRRMFEAARALGL
PVKLHADQLSDLGGGALAAAFDGLSADHVEHTSEDSVRAMAQAGTVAVLLPGAFHVLRET
ALPPLEAFRSHGVPMAVATDCNPGTSPLQSLRHAMQLACTHFRLSPEEALRGATVNAARA
LGLHDRGVLRVGARADFVLWNIQHPAELCYWLGGRLAQAVHAGGHRVT