Protein Info for ABIE51_RS06015 in Lysobacter sp. OAE881

Annotation: methylisocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02317: methylisocitrate lyase
  • amino acids 8 to 291 (284 residues), 418.6 bits, E=5.7e-130
• PF13714: PEP_mutase
  • amino acids 11 to 252 (242 residues), 150.9 bits, E=4.7e-48
• PF00463: ICL
  • amino acids 81 to 176 (96 residues), 53.8 bits, E=1.3e-18

Best Hits

Swiss-Prot: 66% identical to PRPB_CUPNE: 2-methylisocitrate lyase (prpB) from Cupriavidus necator

KEGG orthology group: K03417, methylisocitrate lyase [EC: 4.1.3.30] (inferred from 84% identity to bcj:BCAM2703)

MetaCyc: 67% identical to 2-methylcitrate lyase (Cupriavidus necator)
Methylisocitrate lyase. [EC: 4.1.3.30]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

• 2-methylcitrate cycle I (5/5 steps found)
• 2-methylcitrate cycle II (4/6 steps found)

KEGG Metabolic Maps

• Propanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.30

Protein Sequence (295 amino acids)

>ABIE51_RS06015 methylisocitrate lyase (Lysobacter sp. OAE881)
MNPSNSAGARFRAALSEETPLQVMGAITAYAGLMAKRTGYKALYLSGGGVAANSLGMPDL
GISTMEDVLTDARRIVDATQMPLLVDIDTGWGGAFNIARTIRSFINVGVAAVHMEDQVGQ
KRCGHRPGKEVVPKDEMVDRVKAAVDARTDAGFVIMARTDAAATEGVDAAIERAVAYVEA
GADMIFPEAMNSLDDYRRFKAAVKVPILANLTEFGSTPFFTTDELRDANVDIALYCCGAY
RAMNKAALNFYETVRREGTQKNIVDTLQTRAQLYDFLGYHAYEDKLDSLFASGKK