Protein Info for ABIE51_RS05955 in Lysobacter sp. OAE881

Annotation: 30S ribosomal protein S4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00163: Ribosomal_S4
  • amino acids 3 to 97 (95 residues), 104 bits, E=5.9e-34
• TIGR01017: ribosomal protein uS4
  • amino acids 3 to 209 (207 residues), 253.1 bits, E=9.6e-80
• PF01479: S4
  • amino acids 99 to 145 (47 residues), 72.6 bits, 1.7e-24

Best Hits

Swiss-Prot: 93% identical to RS4_STRM5: 30S ribosomal protein S4 (rpsD) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 92% identity to xal:XALc_0537)

MetaCyc: 66% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial

Protein Sequence (209 amino acids)

>ABIE51_RS05955 30S ribosomal protein S4 (Lysobacter sp. OAE881)
MARYIGPTCKLARREGADLGLKSSARALDSKCKLEQKPGQHGPTARKGKLSDYATQLREK
QKVKRIYGLLERQFRNYYKKASTKKGNTGENLLQLLETRLDNVVYRMGFAVTRPAARQLV
SHRGVTVNGKPVNLPSYQVKAGDAIALAERAQKQLRVQESLTVASQMDLSPSWVEVDSKK
FSGVFKAVPDRADLPADINEALIVELYSK