Protein Info for ABIE51_RS05950 in Lysobacter sp. OAE881
Annotation: 30S ribosomal protein S11
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to RS11_XANCP: 30S ribosomal protein S11 (rpsK) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 97% identity to sml:Smlt0929)MetaCyc: 72% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (130 amino acids)
>ABIE51_RS05950 30S ribosomal protein S11 (Lysobacter sp. OAE881) MAKPAATKTKKKIKRVVTDGIAHVHASFNNTIVTITDRQGNALSWATSGGAGFRGSRKST PFAAQVAAEKAGRAALDYGVKSLEVRIKGPGPGRESAVRSLNNVGYKIINIIDVTPIPHN GCRPPKKRRV