Protein Info for ABIE51_RS05735 in Lysobacter sp. OAE881

Annotation: 50S ribosomal protein L25/general stress protein Ctc

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR00731: ribosomal protein bL25, Ctc-form" amino acids 6 to 173 (168 residues), 133.6 bits, see alignment E=3e-43 PF01386: Ribosomal_L25p" amino acids 6 to 93 (88 residues), 85.6 bits, see alignment E=2.6e-28 PF14693: Ribosomal_TL5_C" amino acids 102 to 186 (85 residues), 83.5 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 72% identical to RL25_XANCB: 50S ribosomal protein L25 (rplY) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 72% identity to xca:xccb100_3476)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ABIE51_RS05735 50S ribosomal protein L25/general stress protein Ctc (Lysobacter sp. OAE881)
MSEHTLKATGRKVEGKGASRRLRHAASIPAIVYGGKSEPKAIQLDHEKIWLAQQNEWFYS
SILNLDIDGTTEAVLLRDIQRHPFKQIIMHLDFQRVDLNAALKASVPLHFIGQEGSPAGK
SADVVITHELNEVTVSCLPRDLPEFIEIDLSNLKVGDIVHLSDVKLPKGVELPELKLGKE
HDVAVVIAKHGRVEAEETAEAPSAEVPATKAAKKDEK