Protein Info for ABIE51_RS05705 in Lysobacter sp. OAE881

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR01035: glutamyl-tRNA reductase" amino acids 4 to 411 (408 residues), 424.6 bits, see alignment E=2.1e-131 PF05201: GlutR_N" amino acids 6 to 152 (147 residues), 181 bits, see alignment E=1.9e-57 PF01488: Shikimate_DH" amino acids 168 to 301 (134 residues), 152 bits, see alignment E=1.6e-48 PF00745: GlutR_dimer" amino acids 316 to 411 (96 residues), 64.5 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 70% identical to HEM1_STRM5: Glutamyl-tRNA reductase (hemA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 70% identity to xal:XALc_0487)

MetaCyc: 49% identical to glutamyl-tRNA reductase (Escherichia coli K-12 substr. MG1655)
Glutamyl-tRNA reductase. [EC: 1.2.1.70]

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>ABIE51_RS05705 glutamyl-tRNA reductase (Lysobacter sp. OAE881)
MSLFVLGINHQTAPVSLRERVAFSAETVPAALDALKTLPQVQEVALLSTCNRTELYAVSN
DDGQALADWLATHPDDIGDLHAYLYRHRDADAVRHLFRVATGLDSLVLGEPQILGQVKDA
WATARHAGTLGSQLDRLFQHAFTTAKRARTDTRIGANPVSVASAAVRLAQESFARLEDST
VLMIGAGETIELAARHLVQARAKRLLVANRTLAHAQELASRHGGFALPLSEIDKHLGEAD
VVISATASRDPILQRPHVAAALATRKHRPMLLLDLAVPRDIAPDVAELKDVFLYTVDDLE
RAIEDNRRSRREAATEAEAIVELQVARFTETMVASTRTEPLKRLRAHGEAAKADVLSRAQ
QQLAAGQDPAEVLNYLAHTLTNRLLHAPTIALREAALTGNAELARAAEKLFAEGDIARNE
SPVEGHDKREA