Protein Info for ABIE51_RS05690 in Lysobacter sp. OAE881

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 PF13432: TPR_16" amino acids 11 to 56 (46 residues), 18.7 bits, see alignment 4.1e-07 amino acids 28 to 90 (63 residues), 32.9 bits, see alignment E=1.6e-11 amino acids 62 to 124 (63 residues), 20.7 bits, see alignment E=9.8e-08 PF13844: Glyco_transf_41" amino acids 200 to 356 (157 residues), 106.1 bits, see alignment E=3e-34 amino acids 366 to 550 (185 residues), 151.8 bits, see alignment E=4.2e-48

Best Hits

KEGG orthology group: None (inferred from 70% identity to smt:Smal_0720)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>ABIE51_RS05690 tetratricopeptide repeat protein (Lysobacter sp. OAE881)
MNHAVDPRIELRRALERNPGDGFAWIVLAEHELDRGDAAAGEAAARRALTLRPGHPEALA
RLGRAQWMLGRKSDAAESLRAAAANAPDHPGIAVWLGHVLEDVGEAEAASDAYARAHALA
PQEPQIAAYLLAWRRKLCDWRDLDALTAQVRAAVNDGTASVEPFAFLSEDASAAEQLRCA
RLRAGMLARQIRPMPPVPPRTHERLRVGFLSNGFGAHPTGLLTAALFEQLRELDELDVHL
FALNADDGSPIRARLQAAAHALHDVAQQAHARVAQRVRDAGIDVLFDLRGWGGGGTPEVL
AMRPARVQANWLAYPGTSGAPWIDFVLADAFVLPDGIERDFSERVVRLPRCFQPSDTTRA
ILPPPTRAECGLPEDAVVFCCFNNSYKLNPRSMSRAFAVLREVPGSVLWLLSGPGNADVR
LRAAAQSSGVDPQRLVFMPKQPHAAYMARLQHADLFLDTEPYNAHTTASDALWAGCPVLT
RPGATFAARVAGSLNHHLGLDAMNVDSDEAFIARAVALGRDPASLQALRAQLAQRRRESG
LFDMAGFARDFTDAVQRMASA