Protein Info for ABIE51_RS05095 in Lysobacter sp. OAE881

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 26 to 97 (72 residues), 67.9 bits, see alignment E=2.2e-22 PF13525: YfiO" amino acids 141 to 258 (118 residues), 46.8 bits, see alignment E=1.1e-15 TIGR02795: tol-pal system protein YbgF" amino acids 141 to 258 (118 residues), 128.3 bits, see alignment E=1.2e-41 PF13512: TPR_18" amino acids 141 to 244 (104 residues), 24.2 bits, see alignment E=1.2e-08 PF13432: TPR_16" amino acids 147 to 209 (63 residues), 26.3 bits, see alignment E=3.1e-09 amino acids 192 to 246 (55 residues), 18.1 bits, see alignment E=1.1e-06 PF13174: TPR_6" amino acids 180 to 210 (31 residues), 22 bits, see alignment 6.4e-08 amino acids 217 to 247 (31 residues), 23 bits, see alignment 3.1e-08

Best Hits

KEGG orthology group: None (inferred from 59% identity to xoo:XOO1670)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>ABIE51_RS05095 tol-pal system protein YbgF (Lysobacter sp. OAE881)
MRKTVLAMAFAAALVAAAPAVAQRASLADRVTVLEQQAANNQGNVDLLNQVTQLRNEIQA
LRSQVEELQQQNQQLMQSSKAQYLDLDGRINRLESGAVVPPAPGATPAPAGSKPAAPSAS
AKDRPPAVYGDKGAIAKSGDERVAYDAAFNALKGGDYVESARLFQAFIETHPEGAYTPNA
LYWLGESYYVTQNYQMAQLQFQSLLDRYPTHDKAPGAMLKIGLSQFNQKQVEAAERTLAD
VSTKYPGTDAARTASDRLNAIQLGRLR