Protein Info for ABIE51_RS05085 in Lysobacter sp. OAE881

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 18 to 432 (415 residues), 529.2 bits, see alignment E=3.8e-163 PF04052: TolB_N" amino acids 26 to 131 (106 residues), 113.5 bits, see alignment E=1.1e-36 PF07676: PD40" amino acids 197 to 231 (35 residues), 35.8 bits, see alignment 1.1e-12 amino acids 246 to 275 (30 residues), 34.2 bits, see alignment (E = 3.8e-12) amino acids 283 to 318 (36 residues), 53.6 bits, see alignment 3.1e-18 amino acids 379 to 404 (26 residues), 11.5 bits, see alignment (E = 4.8e-05)

Best Hits

Swiss-Prot: 80% identical to TOLB_XANAC: Tol-Pal system protein TolB (tolB) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K03641, TolB protein (inferred from 80% identity to xcv:XCV3272)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>ABIE51_RS05085 Tol-Pal system beta propeller repeat protein TolB (Lysobacter sp. OAE881)
MKRSLAWLASLLALLLPLSAMAQQGLEIDIVGGNAAAMPIAVVPMPYQGSATAPQTDVSE
VVAADLARSGQFRPLPAADITEKPTRGGEINYPTWRALNQDYIVVGRVLDAGAGSFRVEY
ELFDVAKQQRLLGFALTARANAMRDVAHQIADAVYEKITGVRGAFFTRIAYVTATGTGRA
AQYALMVADSDGFNPQTVVRSPEPLLSPSWSPDGNRLAYVSFEGGNSSIYIQNISTGARE
LVAKYRGINGAPSFSPDGRRLALTLSRTGNPEIYVMDLGSKNLTQLTNHFAIDTEPTWSA
DGGTIYFTSDRGGRPQIYSVPSSGGSATRVTFQGSYNASASVSFDGKKIATAQGNGNNYR
IALMDSSLGAARWSTLSPGSLDESPSFAPNGAMILYAAREGRRGVLYAVSSDGRVRQRLV
LADGDVREPAWGPFRLPR