Protein Info for ABIE51_RS05060 in Lysobacter sp. OAE881

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 11 to 135 (125 residues), 171.7 bits, see alignment E=7.5e-55 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 14 to 126 (113 residues), 114.1 bits, see alignment E=4.6e-37 PF13279: 4HBT_2" amino acids 17 to 135 (119 residues), 60.5 bits, see alignment E=2.3e-20 PF03061: 4HBT" amino acids 25 to 109 (85 residues), 69 bits, see alignment E=3.6e-23

Best Hits

Swiss-Prot: 47% identical to YBGC_ECOL6: Acyl-CoA thioester hydrolase YbgC (ybgC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 75% identity to xcv:XCV3276)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>ABIE51_RS05060 tol-pal system-associated acyl-CoA thioesterase (Lysobacter sp. OAE881)
MSEEAAIGATFSWPTRVYWEDTDAGGVVYHAQYLAFMERARTEWMRAHGYGQELLRREHD
LVFAVRAMQIDFLKPARLDDALDVEVELIECRRASAVFAQTIRRGDEVLLTAQVRVAALD
AAGFRPRGIPSPLLDELKSLERPR