Protein Info for ABIE51_RS04920 in Lysobacter sp. OAE881

Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00685: trehalose-phosphatase" amino acids 18 to 243 (226 residues), 141.4 bits, see alignment E=4.6e-45 TIGR01484: HAD hydrolase, family IIB" amino acids 20 to 210 (191 residues), 70.4 bits, see alignment E=2.3e-23 PF02358: Trehalose_PPase" amino acids 21 to 235 (215 residues), 113.8 bits, see alignment E=7e-37

Best Hits

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 48% identity to smt:Smal_3153)

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>ABIE51_RS04920 trehalose-phosphatase (Lysobacter sp. OAE881)
MSTPTLSLPAPPAVSSEWALFLDVDGTLLDFADVPGDVAVDPGLIDVLAVLHGRLDGALA
LVSGRRLAQLDELFAPLKLPAVGLHGLERREDGHQERHPRPVALDQAVAWGRALAQRYPG
ARVEDKGTTIALHWRAAPDAEDLLRQYADSILIELPGYHLQHGNMVVELRPDGAHKGSAV
VDLLAHPPFHGRRPVFVGDDLTDEHAFQAVCSHAGFGVLVGSRQPSAARYALHDPAAVRA
WLEEGLDLA