Protein Info for ABIE51_RS04880 in Lysobacter sp. OAE881

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 9 to 253 (245 residues), 247.7 bits, see alignment E=5.6e-78 PF13512: TPR_18" amino acids 36 to 173 (138 residues), 129.4 bits, see alignment E=3.7e-41 PF13525: YfiO" amino acids 38 to 240 (203 residues), 194.9 bits, see alignment E=4.3e-61 PF13432: TPR_16" amino acids 45 to 107 (63 residues), 31.8 bits, see alignment E=5.2e-11 amino acids 82 to 121 (40 residues), 17.6 bits, see alignment 1.4e-06 PF13174: TPR_6" amino acids 51 to 69 (19 residues), 12.7 bits, see alignment (E = 5.2e-05) amino acids 76 to 107 (32 residues), 20.8 bits, see alignment 1.4e-07

Best Hits

Swiss-Prot: 69% identical to BAMD_XYLFA: Outer membrane protein assembly factor BamD (bamD) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K05807, putative lipoprotein (inferred from 72% identity to xcv:XCV3343)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ABIE51_RS04880 outer membrane protein assembly factor BamD (Lysobacter sp. OAE881)
MSLRSAPSRLLALLLIVAFAGVGCSKFKDKDADEGVPVETLYEKAHKSMTNGNWAAAETT
FKRLVAQYPYGPYTEQALVETAYAQYKAGKHDDAISSIDRFIRTYPTHKNIAYMYYLRGL
SNSSRDTVFLQKVWTLDASRRDLATPLQAFNDFSIVADRYPNSRYAPDARIRMAGLRDMF
ARHELDTALYYLRRTAYVAAAERAKFLLETYPQSSYQNDAVATLAAAYEGLGNEVLAADA
RRVLQLNDPSHPFLAGKWPDYPSNWRKLNPFAGEKSALDND