Protein Info for ABIE51_RS04865 in Lysobacter sp. OAE881

Annotation: succinate--CoA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01019: succinate-CoA ligase, alpha subunit
  • amino acids 4 to 288 (285 residues), 465.8 bits, E=2.7e-144
• PF02629: CoA_binding
  • amino acids 6 to 99 (94 residues), 119.3 bits, E=2e-38
• PF13380: CoA_binding_2
  • amino acids 21 to 130 (110 residues), 25.5 bits, E=3e-09
• PF13607: Succ_CoA_lig
  • amino acids 146 to 282 (137 residues), 42.3 bits, E=1.3e-14
• PF00549: Ligase_CoA
  • amino acids 152 to 272 (121 residues), 99.5 bits, E=3.2e-32

Best Hits

Swiss-Prot: 68% identical to SUCD_COXBU: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 89% identity to psu:Psesu_0556)

MetaCyc: 67% identical to succinyl-CoA ligase alpha subunit (Homo sapiens)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; Succinate--CoA ligase (GDP-forming). [EC: 6.2.1.5, 6.2.1.4]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• adipate degradation (4/5 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• adipate biosynthesis (3/5 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• methylaspartate cycle (11/19 steps found)
• reductive TCA cycle II (5/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.4 or 6.2.1.5

Protein Sequence (291 amino acids)

>ABIE51_RS04865 succinate--CoA ligase subunit alpha (Lysobacter sp. OAE881)
MSVLINKNTKVIVQGFTGSQGTFHAQQMLEYGTQVVGGVTPGKGGTQHLGLPVFNTVAEA
VKTTGADASVIYVPPPFAADAIMEAAAAGIKVIVCITEGIPVLDMLRAKNALKGYPDTVL
VGPNCPGVITPGECKIGIMPGHIHMPGKIGIVSRSGTLTYEAVKQTTDVGLGQSTCIGIG
GDPINGTNFIDALKLFQEDPQTEGIIMVGEIGGSAEEEAAEFIAKHVTKPVVGFIAGASA
PKGKRMGHAGAIASGGSGTAEGKFAAMEKAGVTTVKSPGDLGAAIAKRLAK