Protein Info for ABIE51_RS04805 in Lysobacter sp. OAE881

Annotation: A24 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details PF06750: A24_N_bact" amino acids 18 to 123 (106 residues), 119.4 bits, see alignment E=5.6e-39 PF01478: Peptidase_A24" amino acids 133 to 241 (109 residues), 102.5 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 76% identical to LEP4_XANCP: Type 4 prepilin-like proteins leader peptide-processing enzyme (xpsO) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 80% identity to xal:XALc_0664)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>ABIE51_RS04805 A24 family peptidase (Lysobacter sp. OAE881)
MAFLDQNPAIGFPLAAGLGLLVGSFLNVVILRLPKRLEWQWRRDSREVLGEPDTYDPPPP
GIVVERSHCPHCKHQLSWYENIPVFSYVVLGGKCRNCKAPISPQYPLVELLTMLLVVASV
WRFGFGWQGFGAIVFTCFLIVLSGIDLRTQLLPDQLTLPLMWLGLIAASDNLYFPAKPAL
LGAVAGYLSLWIVWWLFKQLTGKEGMGHGDFKLLAAIGAWTGLKGILPTILLSSVVGAVV
GSIWLAMKGRDRATPIPFGPYLAIAGWITFFWGEQMVGAYMQFAGLK