Protein Info for ABIE51_RS04755 in Lysobacter sp. OAE881

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 23 to 319 (297 residues), 321 bits, E=3.4e-100
• PF01820: Dala_Dala_lig_N
  • amino acids 71 to 107 (37 residues), 34.6 bits, 3.7e-12
• PF02786: CPSase_L_D2
  • amino acids 117 to 287 (171 residues), 24.5 bits, E=2.8e-09
• PF07478: Dala_Dala_lig_C
  • amino acids 125 to 316 (192 residues), 170 bits, E=7.3e-54

Best Hits

Swiss-Prot: 73% identical to DDLB_XANCP: D-alanine--D-alanine ligase B (ddlB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 74% identity to sml:Smlt0757)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (10/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (328 amino acids)

>ABIE51_RS04755 D-alanine--D-alanine ligase (Lysobacter sp. OAE881)
MSAQSAAAKLGPTRITDPAAFGRVAVLMGGTSAEREVSLDSGRNVLEALRSRGVDAFAVD
GIPALIDAIRAGSVDRVFNILHGNKGGGEDGVLQGLCEALGVPYTGSDVLGSALTMDKIR
TKQVWLSIGLPTPRYVRLAKGGDVHAAARELGLPVFIKPSSEGSSVGVSRVLSDADLDAA
VELAANYPGEMLMEQLIVGEELTVPVLNDIALPSIRIVPKGEWYDYHAKYISDDTQYLCP
GLEGAAEAEIGRIAAEAFVAAGCRGWGRVDFMRDRATGQLYLLEVNTAPGMTSHSLVPKA
ARQIGIEFDELCWRVLESSLANAGGAAA