Protein Info for ABIE51_RS04710 in Lysobacter sp. OAE881

Annotation: 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF01795: Methyltransf_5" amino acids 8 to 307 (300 residues), 329.5 bits, see alignment E=1.3e-102 TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase" amino acids 8 to 307 (300 residues), 325.8 bits, see alignment E=1.5e-101

Best Hits

Swiss-Prot: 80% identical to RSMH_STRMK: Ribosomal RNA small subunit methyltransferase H (rsmH) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 80% identity to sml:Smlt0748)

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>ABIE51_RS04710 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH (Lysobacter sp. OAE881)
MERGALSGHLPVMYAQVLDGLDVRGSGTYLDGTFGRGGHARGVLERLGPGGRLLLMDKDP
EAIAVAMREFAQDARVAVFRGSFAELSNWDETAAGLDGVLFDLGVSSPQLDVAERGFSFG
KDGPLDMRMDPDSGESAAQWLARADDREIADVLWTYGEERMSRKIARAIVARRDAQPLER
TAQLADLIASVVPRGDQKIHPATRSFQAIRIFINRELVDLETGLDAALARLKPGGRLAVI
SFHSLEDRIVKQFIARHSKAPPANRRMPVEVAFTPVLRAIGGAQKATDEETSANPRARSA
VLRVAEKLGIGNEEGESASDGVSDTAQPATGRGDRRNAMAPGEPALQRPRLSRTRFPAGA
VELHAEVRA