Protein Info for ABIE51_RS04560 in Lysobacter sp. OAE881

Annotation: PilN domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 236 to 257 (22 residues), see Phobius details PF05137: PilN" amino acids 311 to 383 (73 residues), 40.1 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 51% identical to GSPL_XANCP: Type II secretion system protein L (pefL) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 51% identity to xcc:XCC0667)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>ABIE51_RS04560 PilN domain-containing protein (Lysobacter sp. OAE881)
MNARSESRPPTRPAADWAQDRLRRLGARLAPGAGGFAHWWAHNLAAWLPARVRRVLGFDR
GRLLMQVQGDAVQVRLQQGGDLRDLGAVPQLALPGEDAIVAPVDPLATLLPPRLADLPRW
LLLPAAAGLRRPLTLPGAAGDRLRDVVGFEIDRQTPFTADNVAFDARVLGRRDADGLIEA
ELVVVPRQRLDAPLSSLGPMADSLAGIDLCAENGQPLGVNLLDPALRRRHGDAFRYWNLA
LAAVAVIAVAATMWQLLANRRAAADELEARIASQATAARSAAAERQALIDLIEGQAFLDR
ERAQRPTTVEVLDELTQRLPDSTYLEKLAIEDNNLLMIGLSREAPSLVQRLQGSKLWRAP
SLTGALMPDPVSGRDRFTLTAELGTPASAAQRAPAPSQPQPEDADGG